PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00038161-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family Nin-like
Protein Properties Length: 468aa    MW: 51372.5 Da    PI: 4.7896
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00038161-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.11.7e-28329378352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +i+l++ls+yF++pi++AAkeL+v+lTvLK++CR++GI+RWPhRk+ksl
  PSME_00038161-RA 329 TDITLSELSHYFNMPITQAAKELKVGLTVLKKRCREFGIPRWPHRKMKSL 378
                       68**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.838315398IPR003035RWP-RK domain
PfamPF020423.5E-23331378IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MPRNSELFDI SPFPEDLNIV DDIFETKDLL DPSDSIPSLC ESSDITDPAS CSLSKPLSLQ  60
SNPPEWDISN WSSIPAASIV SEIMNPTNEF PAEDQVLAGG LNQNTELSWG DKLPNIQISS  120
PRRLPGSLIS FSSLHPHCDE LYTGTLSLFS PSSSNIYVDV KPKVQIADDR HGGYCSSIYI  180
CNEELPSDQL SGFANLQVEV PPTCEQIYDN KQLGLCSDLV CNFGSCLETT PGLSSDESIG  240
TSHQNLCPPT NMAGAEGIEY TFPPFYNLHS MPETPNPIYA SNSPSIIRDD PSYINSSWTG  300
VNNKTAISSG PSAQSRAGSH QRGSTDRITD ITLSELSHYF NMPITQAAKE LKVGLTVLKK  360
RCREFGIPRW PHRKMKSLES LIHNIQELGK NNGGLSNARL RNAVQILEEQ KRLMEEMPGI  420
ELAERTKRLR QACFKASYKK RRQMAMESAN QGCSDGSTSS ASATQASI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.14e-42RWP-RK domain-containing protein